PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G24190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 372aa    MW: 38943.4 Da    PI: 7.0644
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G24190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.11.7e-22113157246
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                      pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  OPUNC03G24190.1 113 PRMRWTTALHAHFVQAVELLGGHERATPKSVLELMNVKDLTLAHM 157
                      9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.16E-8110156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-19110157IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-15113156IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MATTAATAPD LSLHISPPSP PDMAAGGEMM EQLAEPKLCL GFGTAPAEQY NNGGCNLQQQ  60
QQQQRLHQPS QIQRFKKSAS GSPVCSGSVG GCGGAAARSG NGGGGGKRSS RAPRMRWTTA  120
LHAHFVQAVE LLGGHERATP KSVLELMNVK DLTLAHMYRT VKGTTDRTCA EGPGQMRDMG  180
FLRRGGSEVD GFDVLGNTSS IAIANIRRQA AGSPGEHHRQ EMISNAWCQQ PFAQQQSTCG  240
LPLPCPYIMS AHHYLVKQNQ VASCSCRLDA DDVVAAAAGP TDDDDDDVVD DDDEGQQRRS  300
SASMHEAAAT AAADAIEGAK PGDQPREAGV AKQQRQQQLG AAAAASSAPA AAAAQRGVLG  360
VQRTNATKVL VR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0927801e-141AC092780.6 Oryza sativa chromosome 3 BAC OSJNBb0079B16 genomic sequence, complete sequence.
GenBankAP0149591e-141AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629914.11e-133PREDICTED: uncharacterized protein LOC9269134 isoform X1
RefseqXP_015629915.11e-133PREDICTED: uncharacterized protein LOC9269134 isoform X2
TrEMBLA0A0E0KGG00.0A0A0E0KGG0_ORYPU; Uncharacterized protein
STRINGBGIOSGA013148-PA1e-103(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-23G2-like family protein